Sequence details NCBI ID: XP_004921268.1 (Protein)

Details from NCBI annotation

Gene Symbol unclassified transcription discrepancy
Protein Name PREDICTED: LOW QUALITY PROTEIN: membrane protein, palmitoylated 4 (MAGUK p55 subfamily member 4) [Heterocephalus glaber]

Database interlinks

Part of XM_004921211.1 (Coding sequence)

For more information consult the page for XM_004921211.1 (Coding sequence)

Sequence Protein

Length: 135 aa     
Raw sequence   
>XP_004921268.1
MVPLIQGQLQPYQKASIFPAALRNWFSASLSGILRLLLXELSLFYSRDMSGXSLLYDLLRSPWLQALLKVYGCLQEFREKKPVPTTLCAQQLSWEVGDSTPHSSGAPMDTTLPAVLAEVTYNTVVEVWRLCLLSF