Sequence details NCBI ID: XP_004874160.1 (Protein)

Details from NCBI annotation

Gene Symbol Fxyd4
Protein Name PREDICTED: FXYD domain-containing ion transport regulator 4 [Heterocephalus glaber]

Database interlinks

Part of XM_004874103.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004874103.1 (Coding sequence)

Sequence Protein

Length: 151 aa     
View alignmentsRaw sequence   
>XP_004874160.1
MVWRPPPPGQGGTIHEIRLQKHPEAPGPAGLPSEQEYYRAYQHHPSPFLSTANLQSPDLPEGGAMAAVTQAFLLGLAGLPSTEAIDLFEKESPFYYDWESLQLGGMIFGGLLCIAGIAWVLSGKCKCKRNKGHSPLPKKGTSVLMPGVSAC