Sequence details NCBI ID: XP_004872266.1 (Protein)

Details from NCBI annotation

Gene Symbol Lsm5
Protein Name PREDICTED: U6 snRNA-associated Sm-like protein LSm5 isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004872209.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004872209.1 (Coding sequence)

Sequence Protein

Length: 91 aa     
View alignmentsRaw sequence   
>XP_004872266.1
MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV