Sequence details NCBI ID: XP_004872172.1 (Protein)

Details from NCBI annotation

Gene Symbol Cib2
Protein Name PREDICTED: calcium and integrin-binding family member 2 isoform X5 [Heterocephalus glaber]

Database interlinks

Part of XM_004872115.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004872115.1 (Coding sequence)

Sequence Protein

Length: 187 aa     
View alignmentsRaw sequence   
>XP_004872172.1
MGNKQTIFTEEQLDNYQDCTFFNKKDILKLHARFYELAPNLVPMDYRKSPIVHVPRSLIIQMPELRENPFKERIVEAFSEDGEGNLTFNDFVDMFSVLCESAPRELKANYAFKIYDFNTDNFICKEDLELTLARLTKSELDEDEVVLVCDKVIEEADLDGDGKLGFADFEDMIAKAPDFLSTFHIRI