Sequence details NCBI ID: XP_004871171.1 (Protein)

Details from NCBI annotation

Gene Symbol Timm9
Protein Name PREDICTED: mitochondrial import inner membrane translocase subunit Tim9 isoform X8 [Heterocephalus glaber]

Database interlinks

Part of XM_004871114.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004871114.1 (Coding sequence)

Sequence Protein

Length: 89 aa     
View alignmentsRaw sequence   
>XP_004871171.1
MAAQISESDQIKQFREFLGTYNKLTETCFLDCVKDFTTREVKPEEITCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR