Sequence details NCBI ID: XP_004870753.1 (Protein)

Details from NCBI annotation

Gene Symbol Coprs
Protein Name PREDICTED: coordinator of PRMT5 and differentiation stimulator [Heterocephalus glaber]

Database interlinks

Part of XM_004870696.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004870696.1 (Coding sequence)

Sequence Protein

Length: 182 aa     
View alignmentsRaw sequence   
>XP_004870753.1
MDTQVAGAQAPEAAGPPRGPSLLSTREAPRSPEAPFFTFKTGLIIPVSYGSGDLPVIDFLASGAQSIPNNIPTHGEDTHCKEEGFAVEKNTWELSEGTRCPLKEQTADLFNEDWDLELKADQGNPYDADDIQGSIYQEIKPWVCCAPQGDMIYDPSWHHPPPLIPHYSKMVFETGQFDDAED