Sequence details NCBI ID: XP_004870669.1 (Protein)

Details from NCBI annotation

Gene Symbol Spaca3
Protein Name PREDICTED: sperm acrosome membrane-associated protein 3 isoform X3 [Heterocephalus glaber]

Database interlinks

Part of XM_004870612.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004870612.1 (Coding sequence)

Sequence Protein

Length: 160 aa     
View alignmentsRaw sequence   
>XP_004870669.1
MEARRSWTPRSWLCPPVMMLLVLTSLLSSSEAKVYSRCELAKVLRDFGLDGYRGYSLADWVCLAYFTSGFNTGAVGHEADGSTNNGIFQINSRKWCKNLTPDSSNRCQVYCSDLLNPNLKVTVICAMKIAQEPQGLGNWEAWRHHCQGKELSYWVDGCDF