Sequence details NCBI ID: XP_004870214.1 (Protein)

Details from NCBI annotation

Gene Symbol unclassified transcription discrepancy
Protein Name PREDICTED: LOW QUALITY PROTEIN: signaling threshold-regulating transmembrane adapter 1 [Heterocephalus glaber]

Database interlinks

Part of XM_004870157.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004870157.1 (Coding sequence)

Sequence Protein

Length: 197 aa     
View alignmentsRaw sequence   
>XP_004870214.1
MNVAEPQLSAVCLWTGFTSAVMIKGDNCTDPPVLGFPSITQAWGLWALLGVVTLLLLISLAALLFQWTNGQSRSQPGHGHSGASVEEVPLYGNLHYLQTGRLSQEPGPGQQDPSLGGSAKVAEEVMCYTSLQLPPPQGWIPSSGTPIKYSEVVVDSEPKLQALDIEPELYASVCAQTRRARASFPDQAYANSQPVPS