Sequence details NCBI ID: XP_004869836.1 (Protein)

Details from NCBI annotation

Gene Symbol Timm10
Protein Name PREDICTED: mitochondrial import inner membrane translocase subunit Tim10 [Heterocephalus glaber]

Database interlinks

Part of XM_004869779.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004869779.1 (Coding sequence)

Sequence Protein

Length: 90 aa     
View alignmentsRaw sequence   
>XP_004869836.1
MDPLRAQQLAAELEVEMMADMYNRMTNACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLTELSMQDEELMKRVQQSSGPV