Sequence details NCBI ID: XP_004869733.1 (Protein)

Details from NCBI annotation

Gene Symbol Ndufc2
Protein Name PREDICTED: NADH dehydrogenase [ubiquinone] 1 subunit C2 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004869676.1 (Coding sequence)

There are 3 potential gene matches.

For more information consult the page for XM_004869676.1 (Coding sequence)

Sequence Protein

Length: 120 aa     
Raw sequence   
>XP_004869733.1
MMAGRPGRVPLQFVPDEARNLPPPKLTDSRLLYCGFLGYCSGLLDNALRRRPPLTAGVHRQLLYVTSFMFVGYYLLKRQDYISAIRDHDMFAYIKSHPEDFHKKEEKTYGDILEEFHPVR