Sequence details NCBI ID: XP_004869305.1 (Protein)

Details from NCBI annotation

Gene Symbol Btf3l4
Protein Name PREDICTED: transcription factor BTF3 homolog 4 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004869248.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004869248.1 (Coding sequence)

Sequence Protein

Length: 158 aa     
View alignmentsRaw sequence   
>XP_004869305.1
MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQVLDSKAPKPEDIDEEDDDVPDLVENFDEASKNEAN