Sequence details NCBI ID: XP_004869125.1 (Protein)

Details from NCBI annotation

Gene Symbol Trappc3l
Protein Name PREDICTED: trafficking protein particle complex subunit 3-like protein [Heterocephalus glaber]

Database interlinks

Part of XM_004869068.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004869068.1 (Coding sequence)

Sequence Protein

Length: 181 aa     
View alignmentsRaw sequence   
>XP_004869125.1
MSRPVPRRPEYQKINKDLFVLTYGALVAQLCKDYEKDEDVNKYLDKMGYGIGTRLVEDFLARSCVRRCHSYSEITDIIAQVAFKMYLGVTPSVTCNNASRNEFSLILDKNPLSEFVEELPAGRSSLCYCNLLCGIIRGALEMVHLAADVTFLQDRLKGDSVTEIGITFLKQPNEKKYRRRK