Sequence details NCBI ID: XP_004868808.1 (Protein)

Details from NCBI annotation

Gene Symbol Map2k3
Protein Name PREDICTED: dual specificity mitogen-activated protein kinase kinase 3 [Heterocephalus glaber]

Database interlinks

Part of XM_004868751.1 (Coding sequence)

There are 3 potential gene matches.

For more information consult the page for XM_004868751.1 (Coding sequence)

Sequence Protein

Length: 347 aa     
Raw sequence   
>XP_004868808.1
MESPASSQPASLPQSKGKSKRRKDLRISCVYKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLEKSMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINREGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS