Sequence details NCBI ID: XP_004868702.1 (Protein)

Details from NCBI annotation

Gene Symbol Myl4
Protein Name PREDICTED: myosin light chain 4 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004868645.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004868645.1 (Coding sequence)

Sequence Protein

Length: 195 aa     
View alignmentsRaw sequence   
>XP_004868702.1
MPPKKPEPKKDVAKPAPAASPAPAPASAPEPLKELGFDPKSVKIDFSADQIEEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNAKMLDFETFLPILQHISRNKEQGMFEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLSGQEDANGCINYEAFVKHIMSG