Sequence details NCBI ID: XP_004868672.1 (Protein)

Details from NCBI annotation

Gene Symbol Limd2
Protein Name PREDICTED: LIM domain-containing protein 2 isoform X4 [Heterocephalus glaber]

Database interlinks

Part of XM_004868615.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004868615.1 (Coding sequence)

Sequence Protein

Length: 128 aa     
View alignmentsRaw sequence   
>XP_004868672.1
MFQAAGAAQTTPSHEAKGGGGSSTVQRSKSFSLPAQVKETCTACQKTVYPMERLVADKLIFHNSCFCCKHCHTKLSLGSYAALHGEFYCKPHFQQLFKSKGNYDEGFGRKQHKELWTHKEVDSGTKTA