Sequence details NCBI ID: XP_004867511.1 (Protein)

Details from NCBI annotation

Gene Symbol Srp9
Protein Name PREDICTED: signal recognition particle 9 kDa protein [Heterocephalus glaber]

Database interlinks

Part of XM_004867454.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004867454.1 (Coding sequence)

Sequence Protein

Length: 86 aa     
View alignmentsRaw sequence   
>XP_004867511.1
MPQYQTWEEFSRAAEKLYLADPMRARVVLKYRHADGNLCIKVTDDLVCLVYRTDQAQDVKKIEKFHSQLMRLMVAKESRSVAMETD