Sequence details NCBI ID: XP_004864217.1 (Protein)

Details from NCBI annotation

Gene Symbol Cmtm5
Protein Name PREDICTED: CKLF-like MARVEL transmembrane domain-containing protein 5 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004864160.1 (Coding sequence)

There are 3 potential gene matches.

For more information consult the page for XM_004864160.1 (Coding sequence)

Sequence Protein

Length: 156 aa     
Raw sequence   
>XP_004864217.1
MFSAWDRRDRPPEEAPASGLHGFTMDKTFLSSLKGILLETELALTFIIFICFTASISAYMAAALLEFFITLAFLFLYATQYYQRFDRLNWPCLDFLRCVSAIIIFLVVSFAAVTSREGAAIAAFVFGIILVSVFVYDAFKIYQTEMVSRPTEGDQQ