Sequence details NCBI ID: XP_004864187.1 (Protein)

Details from NCBI annotation

Gene Symbol Emc9
Protein Name PREDICTED: ER membrane protein complex subunit 9 [Heterocephalus glaber]

Database interlinks

Part of XM_004864130.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004864130.1 (Coding sequence)

Sequence Protein

Length: 206 aa     
View alignmentsRaw sequence   
>XP_004864187.1
MGEVEISARAYVKMCLHAARYPHAAVNGLLLAPAPRSRECLCLTDCVPLFHSHLALSVMLEVALNQVDVWGAQAGLVVAGYYHANAALDDQSPGSLALKIAGRIAEFFPDTALIMLDNKKLVPQPPVPPVIVLENQGLRWVPKDKNLVMWRDWDESRQMVGALLEGRAHQHLVDFDCHFDDIRQDWTNQQLNSQITQWVGPTNGNS