Sequence details NCBI ID: XP_004864034.1 (Protein)

Details from NCBI annotation

Gene Symbol Sh3bgrl2
Protein Name PREDICTED: SH3 domain-binding glutamic acid-rich-like protein 2 isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004863977.1 (Coding sequence)

There are 3 potential gene matches.

For more information consult the page for XM_004863977.1 (Coding sequence)

Sequence Protein

Length: 107 aa     
Raw sequence   
>XP_004864034.1
MGVRVFVASSSGSVAIKKKQQDVVRFLEANKIEFEEVDITMSEEQRQWMYKNIPPEKKPAQGNPLPPQIFNGDRYCGDYDSFFESKESNTVLSFLGLKPRLASNAEP