Sequence details NCBI ID: XP_004864031.1 (Protein)

Details from NCBI annotation

Gene Symbol Hmgn3
Protein Name PREDICTED: high mobility group nucleosome-binding domain-containing protein 3 [Heterocephalus glaber]

Database interlinks

Part of XM_004863974.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004863974.1 (Coding sequence)

Sequence Protein

Length: 146 aa     
View alignmentsRaw sequence   
>XP_004864031.1
MNWDFILRSLNFIPRSLSLELSSENIEGKDGSKVTKQEPTRRSARLSTKPAPLKPEPKPRKTSTKKEPGTKVNRGAKGKKEEKQEAGKEGTTPSENGETKAEEIHISRSAVNVSASRSTPPSTLSVKGQIETVRAQKTESVDNEGE