Sequence details NCBI ID: XP_004862781.1 (Protein)

Details from NCBI annotation

Gene Symbol Acn9
Protein Name PREDICTED: protein ACN9 homolog, mitochondrial isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004862724.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004862724.1 (Coding sequence)

Sequence Protein

Length: 125 aa     
View alignmentsRaw sequence   
>XP_004862781.1
MLVKHVSRVRALYRRILQLHRLLPVHLKALGDQYVKDEFRRHKTVGSEEAQRFLQEWEVYAAVLRQQANENRQNSTEKACFGTSLSKEKLNDFRDEQIGQLQELMQEATKPSKQFSITESTKPKF