Sequence details NCBI ID: XP_004862746.1 (Protein)

Details from NCBI annotation

Gene Symbol Gngt1
Protein Name PREDICTED: guanine nucleotide-binding protein G(T) subunit gamma-T1 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004862689.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004862689.1 (Coding sequence)

Sequence Protein

Length: 74 aa     
View alignmentsRaw sequence   
>XP_004862746.1
MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPEDKNPFKELKGGCVIS