Sequence details NCBI ID: XP_004861818.1 (Protein)

Details from NCBI annotation

Gene Symbol Meig1
Protein Name PREDICTED: meiosis expressed gene 1 protein homolog isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004861761.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004861761.1 (Coding sequence)

Sequence Protein

Length: 88 aa     
View alignmentsRaw sequence   
>XP_004861818.1
MASSDVKPKSISRAKKWSEEIENLYRFQQAGYRDEIEYKQVKQVSMVDRWPETGYVKKLQRRDNTFYYYNKQRECDDKEVHTVKIYAY