Sequence details NCBI ID: XP_004861538.1 (Protein)

Details from NCBI annotation

Gene Symbol Kcne1l
Protein Name PREDICTED: potassium voltage-gated channel subfamily E member 1-like protein [Heterocephalus glaber]

Database interlinks

Part of XM_004861481.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004861481.1 (Coding sequence)

Sequence Protein

Length: 141 aa     
View alignmentsRaw sequence   
>XP_004861538.1
MNCSDSQWLQNLLNHLLLELHHQASCLNAGSDSTMGVGVVPDPFGGREVTSAKGDDDYLYILLIMIFYACLAGSFVLAYTRSRKFRKDKEEPSQTCTALPQWASGGALATNAETAAGFLAEGRPLFAPELLLAFDQGAEGV