Sequence details NCBI ID: XP_004860994.1 (Protein)

Details from NCBI annotation

Gene Symbol Pde6g
Protein Name PREDICTED: retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004860937.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004860937.1 (Coding sequence)

Sequence Protein

Length: 87 aa     
View alignmentsRaw sequence   
>XP_004860994.1
MNLELPKAEIRSATRVIGGPVTPRKGPPKFKQRQTRQFKSKPPKKGVQGFGDDIPGMEGLGTDITVICPWEAFNHLELHELAQYGII