Sequence details NCBI ID: XP_004860690.1 (Protein)

Details from NCBI annotation

Gene Symbol Atp5h
Protein Name PREDICTED: ATP synthase subunit d, mitochondrial isoform X5 [Heterocephalus glaber]

Database interlinks

Part of XM_004860633.1 (Coding sequence)

There are 2 potential gene matches.

For more information consult the page for XM_004860633.1 (Coding sequence)

Sequence Protein

Length: 163 aa     
Raw sequence   
>XP_004860690.1
MAGRKLALKAIDWVAFGEIIPPNQRAIANSLKSWNETLSSRLAALSEKPPEIDWAFYKANVAKAGLVDDFEKKFNALKIPVPEDKYTALVDAEEKEDVKSCAEFVSLSKSRIVEYEKQVRMNSGVASVHDMFSLFLMATHLSLIGSNLPWILDFQLCGGIPLY