Sequence details NCBI ID: XP_004860499.1 (Protein)

Details from NCBI annotation

Gene Symbol Rarres2
Protein Name PREDICTED: retinoic acid receptor responder protein 2 [Heterocephalus glaber]

Database interlinks

Part of XM_004860442.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004860442.1 (Coding sequence)

Sequence Protein

Length: 187 aa     
View alignmentsRaw sequence   
>XP_004860499.1
MFPVPLQEPAAPSWQEEASTTVSFQGQGMWRLLIPLALWLGTAGVGGVELTEVQHRGLQVALEEFHKHPPVQWAFQKTSVESAMAMPFPAGTFVRLEFRLQQTGCRKKDWKKLECKVKPNGRKRKCLACIKLDPKHTVLGRMVHCPIETQGQEPQEPQCSKVQRAGEDPHSFYFPGQFAFSKALPSS