Sequence details NCBI ID: XP_004860206.1 (Protein)

Details from NCBI annotation

Gene Symbol Pkib
Protein Name PREDICTED: cAMP-dependent protein kinase inhibitor beta isoform X5 [Heterocephalus glaber]

Database interlinks

Part of XM_004860149.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004860149.1 (Coding sequence)

Sequence Protein

Length: 97 aa     
View alignmentsRaw sequence   
>XP_004860206.1
MSVLSTEKENPGDRFLKEDPAMRTRSPTRPDPEPALSSFAASSRSGRRNALPDILGADASACEELPPPRSLSVKEDVQQKSEAAARDRLGNPREEEK