Sequence details NCBI ID: XP_004858306.1 (Protein)

Details from NCBI annotation

Gene Symbol unclassified transcription discrepancy
Protein Name PREDICTED: LOW QUALITY PROTEIN: WAP four-disulfide core domain protein 5 [Heterocephalus glaber]

Database interlinks

Part of XM_004858249.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004858249.1 (Coding sequence)

Sequence Protein

Length: 164 aa     
View alignmentsRaw sequence   
>XP_004858306.1
MRIQSILLLVALLALGSQVPAASGRRKGEKYGGCPPDDKPCLSVPDQCTGDSQCPSGKKCCSQACFRQCVPRVLVKRGSCPEDRLRCLSPAQHLCNHDHDCPRGKRCCPGACGRDCRNPARGPIVTSLQHIXPWLLLLEVQVHSLTSKALLFITLGLMLSFPPF