Sequence details NCBI ID: XP_004851654.1 (Protein)

Details from NCBI annotation

Gene Symbol Dnajc24
Protein Name PREDICTED: dnaJ homolog subfamily C member 24 [Heterocephalus glaber]

Database interlinks

Part of XM_004851597.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004851597.1 (Coding sequence)

Sequence Protein

Length: 148 aa     
View alignmentsRaw sequence   
>XP_004851654.1
MALEQGPAKDWYGILGAEPSANVSELKQKYQKLILMYHPDKQSTAASAGTPEECLQKFIEVDQAWKILGNEAARKEYDLQRHEDELRSMGPIDAQMYLEEMSWNEGNRSFSLSCRCGGRYVVSEQEAAATSLVPCDTCSLMVELLRDN