Sequence details NCBI ID: XP_004850942.1 (Protein)

Details from NCBI annotation

Gene Symbol Fndc5
Protein Name PREDICTED: fibronectin type III domain-containing protein 5 isoform X3 [Heterocephalus glaber]

Database interlinks

Part of XM_004850885.1 (Coding sequence)

There are 3 potential gene matches.

For more information consult the page for XM_004850885.1 (Coding sequence)

Sequence Protein

Length: 210 aa     
View alignmentsRaw sequence   
>XP_004850942.1
MPPGPPCAWPPRGALRLWLGCVCFALVQADSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMGSKNKDEVTMKEMGRNQQLRTGEVLIIVVVLFMWAGVIALFCRQYDIIKDNEPNNNKEKTKSASETSTPEHQGGGLLRSKI