Sequence details NCBI ID: XP_004850616.1 (Protein)

Details from NCBI annotation

Gene Symbol Id3
Protein Name PREDICTED: DNA-binding protein inhibitor ID-3 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004850559.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004850559.1 (Coding sequence)

Sequence Protein

Length: 119 aa     
View alignmentsRaw sequence   
>XP_004850616.1
MKALSPVRGCYEAVCCLSERSLAIARGRGKSPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTSELAPELVISNDKRSFCH