Sequence details NCBI ID: XP_004841533.1 (Protein)

Details from NCBI annotation

Gene Symbol Gadd45a
Protein Name PREDICTED: growth arrest and DNA damage-inducible protein GADD45 alpha isoform X4 [Heterocephalus glaber]

Database interlinks

Part of XM_004841476.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004841476.1 (Coding sequence)

Sequence Protein

Length: 162 aa     
View alignmentsRaw sequence   
>XP_004841533.1
MTLEEFPAGEQKTERMDTVGDALQEVLSKARSQRSLTVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDIDILRVSNPGRLAELLLLGADAGGEGAAQPPDLHCVLVTNPHASQWKDPALSQLICFCRESRYMDQWVPVINLPER