Sequence details NCBI ID: XP_004841430.1 (Protein)

Details from NCBI annotation

Gene Symbol Samd13
Protein Name PREDICTED: sterile alpha motif domain-containing protein 13 isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004841373.1 (Coding sequence)

There are 3 potential gene matches.

For more information consult the page for XM_004841373.1 (Coding sequence)

Sequence Protein

Length: 115 aa     
Raw sequence   
>XP_004841430.1
MSVAEVKEPCSLPMLSVDMENKENGSVGVKNSMENGRPPDPADWAVMDVVNYFRTAGFEEQAHAFQEQEIDGKSLLLMTRNDVLTGLQLKLGPALKIYEYHVKPLQTKHLKNNSS