Sequence details NCBI ID: XP_004839522.1 (Protein)

Details from NCBI annotation

Gene Symbol Atp6v1e2
Protein Name PREDICTED: V-type proton ATPase subunit E 2 [Heterocephalus glaber]

Database interlinks

Part of XM_004839465.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004839465.1 (Coding sequence)

Sequence Protein

Length: 226 aa     
View alignmentsRaw sequence   
>XP_004839522.1
MALTDAGVQKQIKHMMAFIEQEANEKAKEIDTKAEEEFNIEKGRLVQSQRLKIMEYYEKKEKQIEQQKKIQMSTMRNQVRLKVLTARNNLISELLSDAKLRLSRIVADPLTYQELLDKLVLQALLQLLEPVMIVRSRPQDFLLMVAAVQKAIPEYMMISQKQVQVQIDQEAHLARSAAGGVEVYSCNQMVKVSNTLESRLDLSAQQKMPEIQKALFGANAHRKFVV