Sequence details NCBI ID: XP_004838491.1 (Protein)

Details from NCBI annotation

Gene Symbol Rpp25l
Protein Name PREDICTED: ribonuclease P protein subunit p25-like protein isoform X4 [Heterocephalus glaber]

Database interlinks

Part of XM_004838434.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004838434.1 (Coding sequence)

Sequence Protein

Length: 163 aa     
View alignmentsRaw sequence   
>XP_004838491.1
MEHYRKAGSAELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEAGSARHVVFSGSGRAAGKAVSCAEIVKRRIPGLHQLTKLHFLQTEDSWVPASPDTGLDPLTVRRHVPAVWVLLSRDPLDPSECGYQPPGAPPGLGSVPNSSCGSRLRRRPRDNRS