Sequence details NCBI ID: XP_004838442.1 (Protein)

Details from NCBI annotation

Gene Symbol Ndufb6
Protein Name PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004838385.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004838385.1 (Coding sequence)

Sequence Protein

Length: 128 aa     
View alignmentsRaw sequence   
>XP_004838442.1
MTGYTPDEKLRLQQLRELRRRWLKDQELSLREPVLPPRKMWPLEEFWDRFLLDGALWKNAIFKVYRHSIFAFTHVLIPAWIVHYYIKYHVTTRPYGIVERKPRIFPGDTILETGEVIPPMKEFPDEHH