Sequence details NCBI ID: XP_004838428.1 (Protein)

Details from NCBI annotation

Gene Symbol Mob3b
Protein Name PREDICTED: MOB kinase activator 3B isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004838371.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004838371.1 (Coding sequence)

Sequence Protein

Length: 216 aa     
View alignmentsRaw sequence   
>XP_004838428.1
MSIALKQVFNKDKTFRPKRKFEPGTQRFELHKRAQASLNSGVDLKAAVQLPSGEDQNDWVAVHVVDFFNRINLIYGTICEFCTERTCPVMSGGPKYEYRWQDDLKYKKPTALPAPQYMNLLMDWIEVQINNEEIFPTCVGVPFPKNFLQICKKILCRLFRVFVHVYIHHFDRVIVMGAEAHVNTCYKHFYYFVTEMNLIDRKELEPLKEMTSRMCH