Sequence details NCBI ID: XP_004835178.1 (Protein)

Details from NCBI annotation

Gene Symbol Eif1b
Protein Name PREDICTED: eukaryotic translation initiation factor 1b isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004835121.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004835121.1 (Coding sequence)

Sequence Protein

Length: 113 aa     
View alignmentsRaw sequence   
>XP_004835178.1
MSTIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF