Sequence details NCBI ID: XP_004834993.1 (Protein)

Details from NCBI annotation

Gene Symbol Nme6
Protein Name PREDICTED: nucleoside diphosphate kinase 6 isoform X4 [Heterocephalus glaber]

Database interlinks

Part of XM_004834936.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004834936.1 (Coding sequence)

Sequence Protein

Length: 190 aa     
View alignmentsRaw sequence   
>XP_004834993.1
MMSILRSPQALQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRTRELLWRKEDCRRFYREHEGRFFYQRLVEFMASGPIRAYILAHKDAIGLWRTLMGPTRVFRARHTAPDSIRGSFGLTDTRNTTHGSDSEASASREIAAFFPDFSEQRWYEEEEPWLRHGPVHYSPLGGVHCMARRPGPAGADCAQ