| Gene Symbol | Timm9 |
|---|---|
| Gene Name | translocase of inner mitochondrial membrane 9 homolog (yeast), transcript variant X8 |
| Entrez Gene ID | 101706496 |
For more information consult the page for NW_004624884.1 (Scaffold)
The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.
translocase of inner mitochondrial membrane 9 homolog (yeast)
| Protein Percentage | 100.0% |
|---|---|
| CDS Percentage | 97.38% |
| Ka/Ks Ratio | 0.001 (Ka = 0.0002, Ks = 0.1542) |
translocase of inner mitochondrial membrane 9 homolog (yeast)
| Protein Percentage | 96.63% |
|---|---|
| CDS Percentage | 95.13% |
| Ka/Ks Ratio | 0.10762 (Ka = 0.016, Ks = 0.1485) |
translocase of inner mitochondrial membrane 9
| Protein Percentage | 95.51% |
|---|---|
| CDS Percentage | 92.13% |
| Ka/Ks Ratio | 0.07431 (Ka = 0.0216, Ks = 0.2909) |
translocase of inner mitochondrial membrane 9 homolog (yeast) (Timm9), transcript variant 1, mRNA
| Protein Percentage | 96.63% |
|---|---|
| CDS Percentage | 92.51% |
| Ka/Ks Ratio | 0.05418 (Ka = 0.0158, Ks = 0.2907) |
>XM_004871114.1 ATGGCTGCACAGATATCAGAATCTGATCAGATAAAACAGTTTAGGGAATTCCTGGGAACCTACAATAAACTTACAGAAACCTGCTTTTTGGACTGTGTTAAAGACTTCACAACAAGAGAAGTAAAACCTGAAGAGATCACCTGTTCAGAACATTGCTTACAGAAATATTTAAAAATGACACAAAGAATATCCATGAGATTTCAGGAATACCATATTCAGCAGAATGAGGCCCTGGCAGCCAAAGCGGGACTTCTTGGCCAGCCCCGATAG
Timm9 PREDICTED: mitochondrial import inner membrane translocase subunit Tim9 isoform X8 [Heterocephalus glaber]
Length: 89 aa View alignments>XP_004871171.1 MAAQISESDQIKQFREFLGTYNKLTETCFLDCVKDFTTREVKPEEITCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR