| Gene Symbol | Cnep1r1 |
|---|---|
| Gene Name | CTD nuclear envelope phosphatase 1 regulatory subunit 1, transcript variant X3 |
| Entrez Gene ID | 101714155 |
For more information consult the page for NW_004624757.1 (Scaffold)
The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.
CTD nuclear envelope phosphatase 1 regulatory subunit 1
| Protein Percentage | 99.2% |
|---|---|
| CDS Percentage | 97.07% |
| Ka/Ks Ratio | 0.03094 (Ka = 0.0036, Ks = 0.1166) |
CTD nuclear envelope phosphatase 1 regulatory subunit 1
| Protein Percentage | 99.2% |
|---|---|
| CDS Percentage | 96.53% |
| Ka/Ks Ratio | 0.02795 (Ka = 0.0037, Ks = 0.1338) |
CTD nuclear envelope phosphatase 1 regulatory subunit 1
| Protein Percentage | 99.2% |
|---|---|
| CDS Percentage | 94.13% |
| Ka/Ks Ratio | 0.0147 (Ka = 0.0038, Ks = 0.256) |
CTD nuclear envelope phosphatase 1 regulatory subunit 1 (Cnep1r1), mRNA
| Protein Percentage | 98.4% |
|---|---|
| CDS Percentage | 92.0% |
| Ka/Ks Ratio | 0.02098 (Ka = 0.0076, Ks = 0.3605) |
>XM_004847958.1 ATGAACTCGCTGGAGCAGGCGGAAGATCTAAAGGCTTTCGAGAGGAGACTTACTGAATATATTCATTGCTTGCAACCTGCAACTGGACGTTGGAGAATGCTTCTTATAGTGGTATCTGTCTGTACAGCTACTGGTGCCTGGAACTGGTTAATAGATCCTGAGACACAAAAGGTATCCTTCTTCACATCATTATGGAACCATCCATTTTTCACCATTAGCTGTATCACTCTAATAGGCTTGTTCTTTGCTGGAATACACAAGAGAGTAGTTGCACCATCAATTATAGCTGCTCGGTGTCGAACGATATTAGCAGAGTACAATATGTCTTGTGATGATACAGGAAAACTGATTTTGAAACCTAGGCCTCATGTTCAATGA
Cnep1r1 PREDICTED: nuclear envelope phosphatase-regulatory subunit 1 isoform X3 [Heterocephalus glaber]
Length: 125 aa View alignments>XP_004848015.1 MNSLEQAEDLKAFERRLTEYIHCLQPATGRWRMLLIVVSVCTATGAWNWLIDPETQKVSFFTSLWNHPFFTISCITLIGLFFAGIHKRVVAPSIIAARCRTILAEYNMSCDDTGKLILKPRPHVQ